CBR1 anticorps (Middle Region)
-
- Antigène Voir toutes CBR1 Anticorps
- CBR1 (Carbonyl Reductase 1 (CBR1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CBR1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Carbonyl Reductase 1 antibody was raised against the middle region of CBR1
- Purification
- Affinity purified
- Immunogène
- Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ
- Top Product
- Discover our top product CBR1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Carbonyl Reductase 1 Blocking Peptide, catalog no. 33R-1155, is also available for use as a blocking control in assays to test for specificity of this Carbonyl Reductase 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CBR1 (Carbonyl Reductase 1 (CBR1))
- Autre désignation
- Carbonyl Reductase 1 (CBR1 Produits)
- Synonymes
- anticorps LOC100222525, anticorps MGC131152, anticorps CBR, anticorps SDR21C1, anticorps hCBR1, anticorps 9-KPR, anticorps AW261796, anticorps CR, anticorps Cbr, anticorps carbonyl reductase 1, anticorps carbonyl reductase [NADPH] 1, anticorps carbonyl reductase 1 S homeolog, anticorps carbonyl reductase, anticorps cbr1, anticorps CBR1, anticorps LOC100222525, anticorps cbr1.S, anticorps Smp_033530.3, anticorps LOC610164, anticorps Cbr1
- Sujet
- Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.
- Poids moléculaire
- 30 kDa (MW of target protein)
-