DONSON anticorps (Middle Region)

N° du produit ABIN630570

Cet anticorps anti-DONSON est un anticorps Lapin Polyclonal détectant DONSON dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour DONSON anticorps (Middle Region) (ABIN630570)

Antigène: DONSON (Downstream Neighbor of SON (DONSON))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DONSON est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DONSON anticorps

Épitope: Middle Region

Specificité: DONSON antibody was raised against the middle region of DONSON

Purification: Affinity purified

Immunogène: DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DONSON Blocking Peptide, (ABIN937434), is also available for use as a blocking control in assays to test for specificity of this DONSON antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DONSON antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DONSON

Antigène: DONSON (Downstream Neighbor of SON (DONSON))

Autre désignation: DONSON

Sujet: This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.

Poids moléculaire: 63 kDa (MW of target protein)