RPL30 anticorps (Middle Region)
-
- Antigène Voir toutes RPL30 Anticorps
- RPL30 (Ribosomal Protein L30 (RPL30))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RPL30 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RPL30 antibody was raised against the middle region of RPL30
- Purification
- Affinity purified
- Immunogène
- RPL30 antibody was raised using the middle region of RPL30 corresponding to a region with amino acids LKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTA
- Top Product
- Discover our top product RPL30 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RPL30 Blocking Peptide, catalog no. 33R-5092, is also available for use as a blocking control in assays to test for specificity of this RPL30 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RPL30 (Ribosomal Protein L30 (RPL30))
- Autre désignation
- RPL30 (RPL30 Produits)
- Synonymes
- anticorps BcDNA:RE25263, anticorps BcDNA:RH09938, anticorps CG10652, anticorps Dmel\\CG10652, anticorps L30, anticorps RPL30, anticorps Rp L30, anticorps Rpl30, anticorps anon-EST:fe1D4, anticorps l(2)01265, anticorps l(2)SH0229, anticorps l(2)SH2 0229, anticorps l(2)k09918, anticorps plume, anticorps fa93d05, anticorps wu:fa93d05, anticorps zgc:56640, anticorps zgc:77683, anticorps Ribosomal protein L30, anticorps ribosomal protein L30, anticorps ribosomal protein L30E, anticorps Ribosomal protein L30, component of cytosolic 80S ribosome and 60S large subunit, anticorps 50S ribosomal protein L30, anticorps ribosomal protein L24, anticorps ribosomal protein L30 S homeolog, anticorps 60S ribosomal protein L30, anticorps RpL30, anticorps RPL30, anticorps rpl30, anticorps HVO_RS16975, anticorps RPL24, anticorps Rpl30, anticorps rpl30.S, anticorps LOC101106855
- Sujet
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL30 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene encoding RPL30 is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron.
- Poids moléculaire
- 13 kDa (MW of target protein)
-