Tryptophan Hydroxylase 2 anticorps (N-Term)

N° du produit ABIN630584

Détail du produit anti-Tryptophan Hydroxylase 2 anticorps

Antigène: Tryptophan Hydroxylase 2 (TPH2)

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tryptophan Hydroxylase 2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TPH2 antibody was raised against the N terminal of TPH2

Purification: Affinity purified

Immunogène: TPH2 antibody was raised using the N terminal of TPH2 corresponding to a region with amino acids REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TPH2 Blocking Peptide, catalog no. 33R-7865, is also available for use as a blocking control in assays to test for specificity of this TPH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tryptophan Hydroxylase 2

Antigène: Tryptophan Hydroxylase 2 (TPH2)

Autre désignation: TPH2 (TPH2 Produits)

Synonymes: anticorps ADHD7, anticorps NTPH, anticorps Ntph, anticorps tphR, anticorps wu:fq15a04, anticorps AU043594, anticorps tryptophan hydroxylase 2, anticorps tryptophan hydroxylase 2 (tryptophan 5-monooxygenase), anticorps TPH2, anticorps Tph2, anticorps tph2

Sujet: Tryptophan hydroxylase (TPH, EC 1.14.16.4) is the rate-limiting enzyme in the synthesis of serotonin (5-hydroxytryptamine, or 5HT). 5HT is causally involved in numerous central nervous activities, and it has several functions in peripheral tissues, including the maintenance of vascular tone and gut motility.

Poids moléculaire: 56 kDa (MW of target protein)