TRIM54 anticorps (N-Term)

N° du produit ABIN630592

Cet anticorps Lapin Polyclonal détecte spécifiquement TRIM54 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour TRIM54 anticorps (N-Term) (ABIN630592)

Antigène: TRIM54 (Tripartite Motif Containing 54 (TRIM54))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIM54 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TRIM54 anticorps

Épitope: N-Term

Specificité: TRIM54 antibody was raised against the N terminal of TRIM54

Purification: Affinity purified

Immunogène: TRIM54 antibody was raised using the N terminal of TRIM54 corresponding to a region with amino acids NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIM54 Blocking Peptide, (ABIN5616785), is also available for use as a blocking control in assays to test for specificity of this TRIM54 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIM54

Antigène: TRIM54 (Tripartite Motif Containing 54 (TRIM54))

Autre désignation: TRIM54

Sujet: TRIM54 contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles.

Poids moléculaire: 45 kDa (MW of target protein)