MBD3 anticorps (N-Term)

N° du produit ABIN630599

Détail du produit anti-MBD3 anticorps

Antigène: MBD3 (Methyl-CpG Binding Domain Protein 3 (MBD3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MBD3 est non-conjugé

Application: Western Blotting (WB)

Specificité: MBD3 antibody was raised against the N terminal of MBD3

Purification: Affinity purified

Immunogène: MBD3 antibody was raised using the N terminal of MBD3 corresponding to a region with amino acids SKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MBD3 Blocking Peptide, catalog no. 33R-8560, is also available for use as a blocking control in assays to test for specificity of this MBD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MBD3

Antigène: MBD3 (Methyl-CpG Binding Domain Protein 3 (MBD3))

Autre désignation: MBD3 (MBD3 Produits)

Synonymes: anticorps xmbd3, anticorps MGC69548, anticorps MBD3, anticorps DKFZp459N1635, anticorps AI181826, anticorps AU019209, anticorps methyl-CpG binding domain protein 3 S homeolog, anticorps methyl-CpG binding domain protein 3, anticorps mbd3.S, anticorps mbd3, anticorps MBD3, anticorps Mbd3

Sujet: DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD).

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Chromatin Binding