WDR77 anticorps (N-Term)

N° du produit ABIN630615

Cet anticorps anti-WDR77 est un anticorps Lapin Polyclonal détectant WDR77 dans WB. Adapté pour Humain.

Aperçu rapide pour WDR77 anticorps (N-Term) (ABIN630615)

Antigène: WDR77 (WD Repeat Domain 77 (WDR77))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR77 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-WDR77 anticorps

Épitope: N-Term

Specificité: WDR77 antibody was raised against the N terminal of WDR77

Purification: Affinity purified

Immunogène: WDR77 antibody was raised using the N terminal of WDR77 corresponding to a region with amino acids MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR77 Blocking Peptide, (ABIN5617003), is also available for use as a blocking control in assays to test for specificity of this WDR77 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR77 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR77

Antigène: WDR77 (WD Repeat Domain 77 (WDR77))

Autre désignation: WDR77

Sujet: WDR77 is the non-catalytic component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. This modification targets Sm proteins to the survival of motor neurons (SMN) complex for assembly into small nuclear ribonucleoprotein core particles. WDR77 might play a role in transcription regulation.

Poids moléculaire: 38 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization