PIP5KL1 anticorps (Middle Region)

N° du produit ABIN630616

Cet anticorps Lapin Polyclonal détecte spécifiquement PIP5KL1 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour PIP5KL1 anticorps (Middle Region) (ABIN630616)

Antigène: PIP5KL1 (Phosphatidylinositol-4-Phosphate 5-Kinase-Like 1 (PIP5KL1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIP5KL1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PIP5KL1 anticorps

Épitope: Middle Region

Specificité: PIP5 KL1 antibody was raised against the middle region of PIP5 L1

Purification: Affinity purified

Immunogène: PIP5 KL1 antibody was raised using the middle region of PIP5 L1 corresponding to a region with amino acids VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIP5KL1 Blocking Peptide, (ABIN5615385), is also available for use as a blocking control in assays to test for specificity of this PIP5KL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIP0 L1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIP5KL1

Antigène: PIP5KL1 (Phosphatidylinositol-4-Phosphate 5-Kinase-Like 1 (PIP5KL1))

Autre désignation: PIP5KL1

Sujet: PIP5KL1 may act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Inositol Metabolic Process