MVP anticorps (N-Term)

N° du produit ABIN630625

Cet anticorps Lapin Polyclonal détecte spécifiquement MVP dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour MVP anticorps (N-Term) (ABIN630625)

Antigène: MVP (Major Vault Protein (MVP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MVP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MVP anticorps

Épitope: N-Term

Specificité: MVP antibody was raised against the N terminal of MVP

Purification: Affinity purified

Immunogène: MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MVP Blocking Peptide, (ABIN5614886), is also available for use as a blocking control in assays to test for specificity of this MVP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MVP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MVP

Antigène: MVP (Major Vault Protein (MVP))

Autre désignation: MVP

Sujet: MVP is required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. MVP down-regulates INFG-mediated STAT1 signaling and subsequent activation of JAK. MVP down-regulates SRC activity and signaling through MAP kinases.

Poids moléculaire: 98 kDa (MW of target protein)