MVP anticorps (N-Term)
-
- Antigène Voir toutes MVP Anticorps
- MVP (Major Vault Protein (MVP))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MVP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MVP antibody was raised against the N terminal of MVP
- Purification
- Affinity purified
- Immunogène
- MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM
- Top Product
- Discover our top product MVP Anticorps primaire
-
anti-Major Vault Protein (MVP) (AA 1-893) antibody
MVP Reactivité: Humain WB, ELISA, IF, IHC (p) Hôte: Souris Monoclonal 2H3-1A6 unconjugated
anti-Major Vault Protein (MVP) antibodyMVP Reactivité: Humain, Souris, Rat WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Major Vault Protein (MVP) (AA 2-272) antibodyMVP Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Major Vault Protein (MVP) antibodyKO Validated MVP Reactivité: Humain WB, IF, IHC (p), ICC Hôte: Lapin Polyclonal unconjugated
anti-Major Vault Protein (MVP) (C-Term) antibodyMVP Reactivité: Humain WB, FACS, ELISA, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Major Vault Protein (MVP) (AA 2-259) antibodyMVP Reactivité: Humain, Souris, Rat WB, IHC, FACS, ELISA, ICC Hôte: Lapin Polyclonal unconjugated
anti-Major Vault Protein (MVP) antibodyMVP Reactivité: Humain, Souris, Rat WB, FACS, ELISA, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Major Vault Protein (MVP) (AA 88-180) antibodyMVP Reactivité: Humain, Poisson zèbre (Danio rerio) FACS, ELISA, IHC (p), IHC (fro), IF (cc), IF (p) Hôte: Lapin Polyclonal unconjugated
anti-Major Vault Protein (MVP) (AA 863-893), (C-Term) antibodyMVP Reactivité: Humain WB, FACS, IHC (p) Hôte: Lapin Polyclonal RB02061 unconjugated
anti-Major Vault Protein (MVP) (AA 403-592) antibodyMVP Reactivité: Humain, Lapin, Boeuf (Vache), Chien WB, IHC, IF, IP Hôte: Souris Monoclonal 42-LRP unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MVP Blocking Peptide, catalog no. 33R-5769, is also available for use as a blocking control in assays to test for specificity of this MVP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MVP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MVP (Major Vault Protein (MVP))
- Autre désignation
- MVP (MVP Produits)
- Synonymes
- anticorps LRP, anticorps VAULT1, anticorps 2310009M24Rik, anticorps cb771, anticorps wu:fb52b05, anticorps wu:fc02g01, anticorps mvp, anticorps MGC145641, anticorps Tb05.45E22.810, anticorps major vault protein, anticorps major vault protein L homeolog, anticorps putative major vault protein, anticorps MVP, anticorps Mvp, anticorps mvp, anticorps mvp.L, anticorps Tc00.1047053510353.10, anticorps Tb927.5.4460, anticorps Tb10.70.0520, anticorps Tb10.70.5840, anticorps LMJF_05_0060
- Sujet
- MVP is required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. MVP down-regulates INFG-mediated STAT1 signaling and subsequent activation of JAK. MVP down-regulates SRC activity and signaling through MAP kinases.
- Poids moléculaire
- 98 kDa (MW of target protein)
-
