VASH1 anticorps (N-Term)

N° du produit ABIN630629

L’anticorps Lapin Polyclonal anti-VASH1 a été validé pour WB. Il convient pour détecter VASH1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour VASH1 anticorps (N-Term) (ABIN630629)

Antigène: VASH1 (Vasohibin 1 (VASH1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VASH1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-VASH1 anticorps

Épitope: N-Term

Specificité: Vasohibin 1 antibody was raised against the N terminal of VASH1

Purification: Affinity purified

Immunogène: Vasohibin 1 antibody was raised using the N terminal of VASH1 corresponding to a region with amino acids ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Vasohibin 1 Blocking Peptide, (ABIN936962), is also available for use as a blocking control in assays to test for specificity of this Vasohibin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VASH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VASH1

Antigène: VASH1 (Vasohibin 1 (VASH1))

Autre désignation: Vasohibin 1

Sujet: VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration.

Poids moléculaire: 41 kDa (MW of target protein)