FTSJ1 anticorps

N° du produit ABIN630633

Détail du produit anti-FTSJ1 anticorps

Antigène: FTSJ1 (FtsJ RNA Methyltransferase Homolog 1 (FTSJ1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FTSJ1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FTSJ1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FTSJ1 Blocking Peptide, catalog no. 33R-6070, is also available for use as a blocking control in assays to test for specificity of this FTSJ1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTSJ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FTSJ1

Antigène: FTSJ1 (FtsJ RNA Methyltransferase Homolog 1 (FTSJ1))

Autre désignation: FTSJ1 (FTSJ1 Produits)

Synonymes: anticorps AI931847, anticorps Ftsj, anticorps Ftsjl, anticorps Sfc12, anticorps CDLIV, anticorps MRX44, anticorps MRX9, anticorps SPB1, anticorps TRMT7, anticorps RGD1561061, anticorps FtsJ RNA methyltransferase homolog 1 (E. coli), anticorps FtsJ RNA methyltransferase homolog 1, anticorps Ftsj1, anticorps FTSJ1

Sujet: FTSJ1 is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA.

Poids moléculaire: 36 kDa (MW of target protein)