ASF1B anticorps

N° du produit ABIN630638

L’anticorps Lapin Polyclonal anti-ASF1B a été validé pour WB. Il convient pour détecter ASF1B dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour ASF1B anticorps (ABIN630638)

Antigène: ASF1B (ASF1 Anti-Silencing Function 1 Homolog B (ASF1B))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASF1B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ASF1B anticorps

Purification: Affinity purified

Immunogène: ASF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASF1B Blocking Peptide, (ABIN936087), is also available for use as a blocking control in assays to test for specificity of this ASF1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASF1B

Antigène: ASF1B (ASF1 Anti-Silencing Function 1 Homolog B (ASF1B))

Autre désignation: ASF1B

Sujet: ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Regulation of Cell Size