QTRTD1 anticorps (N-Term)

N° du produit ABIN630639

Détail du produit anti-QTRTD1 anticorps

Antigène: QTRTD1 (Queuine tRNA-Ribosyltransferase Domain Containing 1 (QTRTD1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp QTRTD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: QTRTD1 antibody was raised against the N terminal of QTRTD1

Purification: Affinity purified

Immunogène: QTRTD1 antibody was raised using the N terminal of QTRTD1 corresponding to a region with amino acids YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

QTRTD1 Blocking Peptide, catalog no. 33R-10263, is also available for use as a blocking control in assays to test for specificity of this QTRTD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QTRTD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur QTRTD1

Antigène: QTRTD1 (Queuine tRNA-Ribosyltransferase Domain Containing 1 (QTRTD1))

Autre désignation: QTRTD1 (QTRTD1 Produits)

Synonymes: anticorps 3110012M05Rik, anticorps 4930470H18Rik, anticorps AI648807, anticorps queuine tRNA-ribosyltransferase accessory subunit 2, anticorps queuine tRNA-ribosyltransferase accessory subunit 2 L homeolog, anticorps QTRT2, anticorps qtrt2, anticorps qtrt2.L, anticorps Qtrt2

Sujet: QTRTD1 belongs to the queuine tRNA-ribosyltransferase family. The function of the QTRTD1 protein remains unknown.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process