Raly anticorps (N-Term)

N° du produit ABIN630644

L’anticorps Lapin Polyclonal anti-Raly a été validé pour WB et IHC. Il convient pour détecter Raly dans des échantillons de Humain.

Aperçu rapide pour Raly anticorps (N-Term) (ABIN630644)

Antigène: Raly (RALY) (RNA-binding protein Raly (RALY))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Raly est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Raly anticorps

Épitope: N-Term

Specificité: RALY antibody was raised against the N terminal of RALY

Purification: Affinity purified

Immunogène: RALY antibody was raised using the N terminal of RALY corresponding to a region with amino acids NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RALY Blocking Peptide, (ABIN5615749), is also available for use as a blocking control in assays to test for specificity of this RALY antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Raly

Antigène: Raly (RALY) (RNA-binding protein Raly (RALY))

Autre désignation: RALY

Sujet: In infectious mononucleosis, anti-EBNA-1 antibodies are produced which cross-react with multiple normal human proteins. The cross-reactivity is due to anti-gly/ala antibodies that cross-react with host proteins containing configurations like those in the EBNA-1 repeat. One such antigen is RALY which is a member of the heterogeneous nuclear ribonucleoprotein gene family.

Poids moléculaire: 30 kDa (MW of target protein)