PPAT anticorps (N-Term)

N° du produit ABIN630652

Cet anticorps Lapin Polyclonal détecte spécifiquement PPAT dans WB et IHC. Il présente une réactivité envers Humain.

Aperçu rapide pour PPAT anticorps (N-Term) (ABIN630652)

Antigène: PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPAT est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PPAT anticorps

Épitope: N-Term

Specificité: PPAT antibody was raised against the N terminal of PPAT

Purification: Affinity purified

Immunogène: PPAT antibody was raised using the N terminal of PPAT corresponding to a region with amino acids VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPAT Blocking Peptide, (ABIN5615489), is also available for use as a blocking control in assays to test for specificity of this PPAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPAT

Antigène: PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))

Autre désignation: PPAT

Sujet: PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.

Poids moléculaire: 56 kDa (MW of target protein)