MAP3K15 anticorps (Middle Region)

N° du produit ABIN630660

Détail du produit anti-MAP3K15 anticorps

Antigène: MAP3K15 (Mitogen-Activated Protein Kinase Kinase Kinase 15 (MAP3K15))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP3K15 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAP3 K15 antibody was raised against the middle region of MAP3 15

Purification: Affinity purified

Immunogène: MAP3 K15 antibody was raised using the middle region of MAP3 15 corresponding to a region with amino acids TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP3K15 Blocking Peptide, catalog no. 33R-9170, is also available for use as a blocking control in assays to test for specificity of this MAP3K15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP3K15

Antigène: MAP3K15 (Mitogen-Activated Protein Kinase Kinase Kinase 15 (MAP3K15))

Autre désignation: MAP3K15 (MAP3K15 Produits)

Synonymes: anticorps MCO15.4, anticorps MCO15_4, anticorps mitogen-activated protein kinase kinase kinase 15, anticorps ASK3, anticorps bA723P2.3, anticorps BC031147, anticorps MEKK15, anticorps mitogen-activated protein kinase kinase kinase 15, anticorps MAPKKK15, anticorps MAP3K15, anticorps Map3k15

Sujet: MAP3K15 is a component of a protein kinase signal transduction cascade.

Poids moléculaire: 89 kDa (MW of target protein)