KPNA3 anticorps

N° du produit ABIN630663

Cet anticorps anti-KPNA3 est un anticorps Lapin Polyclonal détectant KPNA3 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour KPNA3 anticorps (ABIN630663)

Antigène: KPNA3 (Karyopherin alpha 3 (Importin alpha 4) (KPNA3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KPNA3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KPNA3 anticorps

Purification: Affinity purified

Immunogène: Karyopherin Alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Karyopherin Alpha 3 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KPNA3

Antigène: KPNA3 (Karyopherin alpha 3 (Importin alpha 4) (KPNA3))

Autre désignation: Karyopherin alpha 3

Sujet: The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kDa) can pass through the nuclear pore by nonselective diffusion, larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3 is a protein similar to certain nuclear transport proteins of Xenopus and human.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus