KPNA5 anticorps

N° du produit ABIN630665

Détail du produit anti-KPNA5 anticorps

Antigène: KPNA5 (Karyopherin alpha 5 (Importin alpha 6) (KPNA5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KPNA5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Karyopherin Alpha 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Karyopherin Alpha 5 Blocking Peptide, catalog no. 33R-9366, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KPNA5

Antigène: KPNA5 (Karyopherin alpha 5 (Importin alpha 6) (KPNA5))

Autre désignation: Karyopherin alpha 5 (KPNA5 Produits)

Synonymes: anticorps IPOA6, anticorps SRP6, anticorps Ipoa6, anticorps im:7151662, anticorps zgc:110662, anticorps karyopherin subunit alpha 5, anticorps karyopherin alpha 5 (importin alpha 6), anticorps KPNA5, anticorps Kpna5, anticorps kpna5

Sujet: The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kDa) can pass through the nuclear pore by nonselective diffusion, larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus.

Poids moléculaire: 61 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus