ING3 anticorps (N-Term)

N° du produit ABIN630670

Cet anticorps Lapin Polyclonal détecte spécifiquement ING3 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour ING3 anticorps (N-Term) (ABIN630670)

Antigène: ING3 (Inhibitor of Growth Family, Member 3 (ING3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ING3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ING3 anticorps

Épitope: N-Term

Specificité: ING3 antibody was raised against the N terminal of ING3

Purification: Affinity purified

Immunogène: ING3 antibody was raised using the N terminal of ING3 corresponding to a region with amino acids MDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ING3 Blocking Peptide, (ABIN5614195), is also available for use as a blocking control in assays to test for specificity of this ING3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ING3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ING3

Antigène: ING3 (Inhibitor of Growth Family, Member 3 (ING3))

Autre désignation: ING3

Sujet: ING3 is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers.

Poids moléculaire: 47 kDa (MW of target protein)