CDYL anticorps (N-Term)

N° du produit ABIN630672

Cet anticorps anti-CDYL est un anticorps Lapin Polyclonal détectant CDYL dans WB. Adapté pour Humain.

Aperçu rapide pour CDYL anticorps (N-Term) (ABIN630672)

Antigène: CDYL (Chromodomain Protein, Y-Like (CDYL))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDYL est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CDYL anticorps

Épitope: N-Term

Specificité: CDYL antibody was raised against the n terminal of CDYL

Purification: Affinity purified

Immunogène: CDYL antibody was raised using the N terminal of CDYL corresponding to a region with amino acids YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDYL Blocking Peptide, (ABIN936102), is also available for use as a blocking control in assays to test for specificity of this CDYL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDYL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDYL

Antigène: CDYL (Chromodomain Protein, Y-Like (CDYL))

Autre désignation: CDYL

Sujet: CDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene.

Poids moléculaire: 60 kDa (MW of target protein)