CDYL anticorps (N-Term)
-
- Antigène Voir toutes CDYL Anticorps
- CDYL (Chromodomain Protein, Y-Like (CDYL))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CDYL est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CDYL antibody was raised against the n terminal of CDYL
- Purification
- Affinity purified
- Immunogène
- CDYL antibody was raised using the N terminal of CDYL corresponding to a region with amino acids YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV
- Top Product
- Discover our top product CDYL Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CDYL Blocking Peptide, catalog no. 33R-10137, is also available for use as a blocking control in assays to test for specificity of this CDYL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDYL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CDYL (Chromodomain Protein, Y-Like (CDYL))
- Autre désignation
- CDYL (CDYL Produits)
- Synonymes
- anticorps AI325931, anticorps CDYL1, anticorps chromodomain Y like, anticorps chromodomain protein, Y chromosome-like, anticorps chromodomain Y-like, anticorps CDYL, anticorps Cdyl
- Sujet
- CDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene.
- Poids moléculaire
- 60 kDa (MW of target protein)
-