PIM1 anticorps (N-Term)

N° du produit ABIN630674

L’anticorps Lapin Polyclonal anti-PIM1 a été validé pour WB. Il convient pour détecter PIM1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PIM1 anticorps (N-Term) (ABIN630674)

Antigène: PIM1 (Pim-1 Oncogene (PIM1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIM1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PIM1 anticorps

Épitope: N-Term

Specificité: PIM1 antibody was raised against the N terminal of PIM1

Purification: Affinity purified

Immunogène: PIM1 antibody was raised using the N terminal of PIM1 corresponding to a region with amino acids MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIM1 Blocking Peptide, (ABIN5615379), is also available for use as a blocking control in assays to test for specificity of this PIM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIM1

Antigène: PIM1 (Pim-1 Oncogene (PIM1))

Autre désignation: PIM1

Sujet: PIM1 may affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. Isoform 2 promotes the G1/S transition of the cell cycle via up-regulation of CDK2 activity and phosphorylation of CDKN1B.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process