Actl7b anticorps (Middle Region)

N° du produit ABIN630675

Détail du produit anti-Actl7b anticorps

Antigène: Actl7b (Actin-Like 7b (Actl7b))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Actl7b est non-conjugé

Application: Western Blotting (WB)

Specificité: ACTL7 B antibody was raised against the middle region of ACTL7

Purification: Affinity purified

Immunogène: ACTL7 B antibody was raised using the middle region of ACTL7 corresponding to a region with amino acids KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACTL7B Blocking Peptide, catalog no. 33R-4511, is also available for use as a blocking control in assays to test for specificity of this ACTL7B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Actl7b

Antigène: Actl7b (Actin-Like 7b (Actl7b))

Autre désignation: ACTL7B (Actl7b Produits)

Synonymes: anticorps ACTL7B, anticorps Tact1, anticorps actin-like 7b, anticorps actin like 7B, anticorps Actl7b, anticorps ACTL7B

Sujet: ACTL7B is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.

Poids moléculaire: 46 kDa (MW of target protein)