PARP11 anticorps

N° du produit ABIN630676

Cet anticorps Lapin Polyclonal détecte spécifiquement PARP11 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour PARP11 anticorps (ABIN630676)

Antigène: PARP11 (Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PARP11 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PARP11 anticorps

Purification: Affinity purified

Immunogène: PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PARP11 Blocking Peptide, (ABIN939406), is also available for use as a blocking control in assays to test for specificity of this PARP11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PARP11

Antigène: PARP11 (Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11))

Autre désignation: PARP11

Sujet: PARP1 encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes. PARP1 can be cleaved resulting in fragements of 29 and 85 kDa.

Poids moléculaire: 39 kDa (MW of target protein)