PARP3 anticorps
-
- Antigène Voir toutes PARP3 Anticorps
- PARP3 (Poly (ADP-Ribose) Polymerase Family, Member 3 (PARP3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PARP3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogène
- PARP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP
- Top Product
- Discover our top product PARP3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1-2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PARP3 Blocking Peptide, catalog no. 33R-4994, is also available for use as a blocking control in assays to test for specificity of this PARP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PARP3 (Poly (ADP-Ribose) Polymerase Family, Member 3 (PARP3))
- Autre désignation
- PARP3 (PARP3 Produits)
- Synonymes
- anticorps ADPRT-3, anticorps PARP-3, anticorps PM38, anticorps Adprtl3, anticorps fj17c06, anticorps wu:fj17c06, anticorps zgc:66157, anticorps PARP3, anticorps parp3, anticorps ADPRT3, anticorps ADPRTL2, anticorps ADPRTL3, anticorps ARTD3, anticorps IRT1, anticorps PADPRT-3, anticorps A930002C11Rik, anticorps AW990611, anticorps Adprt3, anticorps pADPRT-3, anticorps seed maturation protein PM38, anticorps poly (ADP-ribose) polymerase family, member 3, anticorps poly(ADP-ribose) polymerase family member 3, anticorps poly(ADP-ribose) polymerase family member 3 L homeolog, anticorps PARP3, anticorps parp3, anticorps parp3.L, anticorps Parp3
- Sujet
- PARP3 belongs to the PARP family. These enzymes modify nuclear proteins by poly-ADP-ribosylation, which is required for DNA repair, regulation of apoptosis, and maintenance of genomic stability. PARP3 is preferentially localized to the daughter centriole throughout the cell cycle. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Poids moléculaire
- 59 kDa (MW of target protein)
-