TUBA3C anticorps (N-Term)

N° du produit ABIN630696

Cet anticorps anti-TUBA3C est un anticorps Lapin Polyclonal détectant TUBA3C dans WB. Adapté pour Humain, Souris, Rat, Drosophila melanogaster et Arabidopsis.

Aperçu rapide pour TUBA3C anticorps (N-Term) (ABIN630696)

Antigène: TUBA3C (Tubulin, Alpha, 3C (TUBA3C))

Reactivité: Humain, Souris, Rat, Drosophila melanogaster, Arabidopsis

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TUBA3C est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TUBA3C anticorps

Épitope: N-Term

Specificité: Alpha Tubulin 3 C antibody was raised against the N terminal of TUBA3

Purification: Affinity purified

Immunogène: alpha Tubulin 3 C antibody was raised using the N terminal of TUBA3 corresponding to a region with amino acids QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

alpha Tubulin 3C Blocking Peptide, (ABIN5612035), is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 3C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TUBA3C

Antigène: TUBA3C (Tubulin, Alpha, 3C (TUBA3C))

Sujet: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Dynamique des Microtubules