RBBP7 anticorps (N-Term)

N° du produit ABIN630697

Cet anticorps Lapin Polyclonal détecte spécifiquement RBBP7 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour RBBP7 anticorps (N-Term) (ABIN630697)

Antigène: RBBP7 (Retinoblastoma Binding Protein 7 (RBBP7))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBBP7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RBBP7 anticorps

Épitope: N-Term

Specificité: RBBP7 antibody was raised against the N terminal of RBBP7

Purification: Affinity purified

Immunogène: RBBP7 antibody was raised using the N terminal of RBBP7 corresponding to a region with amino acids MTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBBP7 Blocking Peptide, (ABIN5615777), is also available for use as a blocking control in assays to test for specificity of this RBBP7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBBP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBBP7

Antigène: RBBP7 (Retinoblastoma Binding Protein 7 (RBBP7))

Autre désignation: RBBP7

Sujet: This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation.

Poids moléculaire: 48 kDa (MW of target protein)