NUP155 anticorps (Middle Region)
-
- Antigène Voir toutes NUP155 Anticorps
- NUP155 (Nucleoporin 155kDa (NUP155))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NUP155 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NUP155 antibody was raised against the middle region of NUP155
- Purification
- Affinity purified
- Immunogène
- NUP155 antibody was raised using the middle region of NUP155 corresponding to a region with amino acids ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY
- Top Product
- Discover our top product NUP155 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NUP155 Blocking Peptide, catalog no. 33R-4155, is also available for use as a blocking control in assays to test for specificity of this NUP155 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP155 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NUP155 (Nucleoporin 155kDa (NUP155))
- Autre désignation
- NUP155 (NUP155 Produits)
- Sujet
- Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. NUP155 does not contain the typical FG repeat sequences found in most vertebrate nucleoporins.
- Poids moléculaire
- 147 kDa (MW of target protein)
- Pathways
- Protein targeting to Nucleus
-