HERC4 anticorps (N-Term)

N° du produit ABIN630701

L’anticorps Lapin Polyclonal anti-HERC4 a été validé pour WB. Il convient pour détecter HERC4 dans des échantillons de Humain et Rat.

Aperçu rapide pour HERC4 anticorps (N-Term) (ABIN630701)

Antigène: HERC4 (Hect Domain and RLD 4 (HERC4))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HERC4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HERC4 anticorps

Épitope: N-Term

Specificité: HERC4 antibody was raised against the n terminal of HERC4

Purification: Affinity purified

Immunogène: HERC4 antibody was raised using the N terminal of HERC4 corresponding to a region with amino acids MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HERC4 Blocking Peptide, (ABIN5613989), is also available for use as a blocking control in assays to test for specificity of this HERC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HERC4

Antigène: HERC4 (Hect Domain and RLD 4 (HERC4))

Autre désignation: HERC4

Sujet: HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins.

Poids moléculaire: 13 kDa (MW of target protein)