FBXL3 anticorps (Middle Region)

N° du produit ABIN630702

Détail du produit anti-FBXL3 anticorps

Antigène: FBXL3 (F-Box and Leucine-Rich Repeat Protein 3 (FBXL3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXL3 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXL3 antibody was raised against the middle region of FBXL3

Purification: Affinity purified

Immunogène: FBXL3 antibody was raised using the middle region of FBXL3 corresponding to a region with amino acids LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXL3 Blocking Peptide, catalog no. 33R-5067, is also available for use as a blocking control in assays to test for specificity of this FBXL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXL3

Antigène: FBXL3 (F-Box and Leucine-Rich Repeat Protein 3 (FBXL3))

Autre désignation: FBXL3 (FBXL3 Produits)

Synonymes: anticorps FBL3, anticorps FBL3A, anticorps FBXL3A, anticorps AU041772, anticorps AW212966, anticorps FBK, anticorps Fbl3a, anticorps Fbxl3a, anticorps Ovtm, anticorps Play68, anticorps fbxl3, anticorps FBXL3, anticorps F7A7.240, anticorps F7A7_240, anticorps im:7153024, anticorps zgc:103721, anticorps F-box and leucine rich repeat protein 3, anticorps F-box and leucine-rich repeat protein 3, anticorps F-box and leucine-rich repeat protein 3 L homeolog, anticorps RNI-like superfamily protein, anticorps F-box and leucine-rich repeat protein 3a, anticorps FBXL3, anticorps Fbxl3, anticorps fbxl3.L, anticorps fbxl3, anticorps AT5G01720, anticorps fbxl3a

Sujet: FBXL3 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats and is localized in the nucleus.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Photoperiodism