ITGB1BP3 anticorps (Middle Region)

N° du produit ABIN630714

Détail du produit anti-ITGB1BP3 anticorps

Antigène: ITGB1BP3 (Integrin beta 1 Binding Protein 3 (ITGB1BP3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ITGB1BP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: ITGB1 BP3 antibody was raised against the middle region of ITGB1 P3

Purification: Affinity purified

Immunogène: ITGB1 BP3 antibody was raised using the middle region of ITGB1 P3 corresponding to a region with amino acids YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ITGB1BP3 Blocking Peptide, catalog no. 33R-10154, is also available for use as a blocking control in assays to test for specificity of this ITGB1BP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB0 P3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ITGB1BP3

Antigène: ITGB1BP3 (Integrin beta 1 Binding Protein 3 (ITGB1BP3))

Autre désignation: ITGB1BP3 (ITGB1BP3 Produits)

Synonymes: anticorps ITGB1BP3, anticorps MIBP, anticorps NRK2, anticorps itgb1bp3, anticorps 2310015C21Rik, anticorps Itgb1bp3, anticorps Mibp, anticorps zgc:103408, anticorps nicotinamide riboside kinase 2, anticorps integrin beta 1 binding protein 3, anticorps nicotinamide riboside kinase 2 S homeolog, anticorps NMRK2, anticorps ITGB1BP3, anticorps nmrk2.S, anticorps nmrk2, anticorps Nmrk2

Sujet: ITGB1BP3 catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN).

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development