EEF1B2 anticorps (Middle Region)

N° du produit ABIN630716

Détail du produit anti-EEF1B2 anticorps

Antigène: EEF1B2 (Eukaryotic Translation Elongation Factor 1 beta 2 (EEF1B2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EEF1B2 est non-conjugé

Application: Western Blotting (WB)

Specificité: EEF1 B2 antibody was raised against the middle region of EEF1 2

Purification: Affinity purified

Immunogène: EEF1 B2 antibody was raised using the middle region of EEF1 2 corresponding to a region with amino acids VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EEF1B2 Blocking Peptide, catalog no. 33R-9624, is also available for use as a blocking control in assays to test for specificity of this EEF1B2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EEF1B2

Antigène: EEF1B2 (Eukaryotic Translation Elongation Factor 1 beta 2 (EEF1B2))

Autre désignation: EEF1B2 (EEF1B2 Produits)

Synonymes: anticorps EEF1B, anticorps EEF1B1, anticorps EF1B, anticorps 2810017J07Rik, anticorps Eef1b, anticorps fj06d02, anticorps wu:fj06d02, anticorps zgc:56277, anticorps zgc:86802, anticorps eef1b, anticorps ef1b, anticorps MGC89655, anticorps eukaryotic translation elongation factor 1 beta 2, anticorps eukaryotic translation elongation factor 1 beta 2 L homeolog, anticorps EEF1B2, anticorps Eef1b2, anticorps eef1b2, anticorps eef1b2.L

Sujet: EEF1B2 is a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.

Poids moléculaire: 25 kDa (MW of target protein)