MLF1 anticorps (N-Term)

N° du produit ABIN630719

L’anticorps Lapin Polyclonal anti-MLF1 a été validé pour WB. Il convient pour détecter MLF1 dans des échantillons de Humain.

Aperçu rapide pour MLF1 anticorps (N-Term) (ABIN630719)

Antigène: MLF1 (Myeloid Leukemia Factor 1 (MLF1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MLF1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MLF1 anticorps

Épitope: N-Term

Specificité: MLF1 antibody was raised against the N terminal of MLF1

Purification: Affinity purified

Immunogène: MLF1 antibody was raised using the N terminal of MLF1 corresponding to a region with amino acids GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MLF1 Blocking Peptide, (ABIN938907), is also available for use as a blocking control in assays to test for specificity of this MLF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MLF1

Antigène: MLF1 (Myeloid Leukemia Factor 1 (MLF1))

Autre désignation: MLF1

Sujet: MLF1 is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. It interferes with erythopoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. MLF1 suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest.It binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus.

Poids moléculaire: 29 kDa (MW of target protein)