CEP55 anticorps (N-Term)

N° du produit ABIN630721

Cet anticorps Lapin Polyclonal détecte spécifiquement CEP55 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour CEP55 anticorps (N-Term) (ABIN630721)

Antigène: CEP55 (Centrosomal Protein 55kDa (CEP55))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CEP55 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CEP55 anticorps

Épitope: N-Term

Specificité: CEP55 antibody was raised against the N terminal of CEP55

Purification: Affinity purified

Immunogène: CEP55 antibody was raised using the N terminal of CEP55 corresponding to a region with amino acids MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CEP55 Blocking Peptide, (ABIN5612824), is also available for use as a blocking control in assays to test for specificity of this CEP55 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEP55 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CEP55

Antigène: CEP55 (Centrosomal Protein 55kDa (CEP55))

Autre désignation: CEP55

Sujet: CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.

Poids moléculaire: 54 kDa (MW of target protein)