IVNS1ABP anticorps (N-Term)

N° du produit ABIN630725

L’anticorps Lapin Polyclonal anti-IVNS1ABP a été validé pour WB et IHC. Il convient pour détecter IVNS1ABP dans des échantillons de Influenza A Virus.

Aperçu rapide pour IVNS1ABP anticorps (N-Term) (ABIN630725)

Antigène: IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))

Reactivité: Influenza A Virus

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IVNS1ABP est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-IVNS1ABP anticorps

Épitope: N-Term

Specificité: Influenza Virus Ns1 A Binding Protein antibody was raised against the N terminal of IVNS1 BP

Réactivité croisée: Humain, Chien

Purification: Affinity purified

Immunogène: Influenza Virus Ns1 A Binding Protein antibody was raised using the N terminal of IVNS1 BP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Influenza Virus Ns1A Binding Protein Blocking Peptide, (ABIN5614193), is also available for use as a blocking control in assays to test for specificity of this Influenza Virus Ns1A Binding Protein antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IVNS0 BP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IVNS1ABP

Antigène: IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))

Autre désignation: Influenza Virus Ns1A Binding Protein

Classe de substances: Influenza Protein

Sujet: This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.

Poids moléculaire: 72 kDa (MW of target protein)

Pathways: Negative Regulation of intrinsic apoptotic Signaling