PARP6 anticorps

N° du produit ABIN630726

Cet anticorps anti-PARP6 est un anticorps Lapin Polyclonal détectant PARP6 dans WB et IHC. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour PARP6 anticorps (ABIN630726)

Antigène: PARP6 (Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PARP6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PARP6 anticorps

Purification: Affinity purified

Immunogène: PARP6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PARP6 Blocking Peptide, (ABIN939914), is also available for use as a blocking control in assays to test for specificity of this PARP6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PARP6

Antigène: PARP6 (Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6))

Autre désignation: PARP6

Sujet: Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.

Poids moléculaire: 59 kDa (MW of target protein)