NSUN2 anticorps (C-Term)

N° du produit ABIN630733

Détail du produit anti-NSUN2 anticorps

Antigène: NSUN2 (NOP2/Sun Domain Family, Member 2 (NSUN2))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NSUN2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NSUN2 antibody was raised against the C terminal of NSUN2

Purification: Affinity purified

Immunogène: NSUN2 antibody was raised using the C terminal of NSUN2 corresponding to a region with amino acids FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NSUN2 Blocking Peptide, catalog no. 33R-2934, is also available for use as a blocking control in assays to test for specificity of this NSUN2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NSUN2

Antigène: NSUN2 (NOP2/Sun Domain Family, Member 2 (NSUN2))

Autre désignation: NSUN2 (NSUN2 Produits)

Synonymes: anticorps D13Wsu123e, anticorps Misu, anticorps MISU, anticorps MRT5, anticorps SAKI, anticorps TRM4, anticorps RGD1311954, anticorps NOL1/NOP2/Sun domain family member 2, anticorps NOP2/Sun RNA methyltransferase family member 2, anticorps NOP2/Sun RNA methyltransferase family, member 2, anticorps NOP2/Sun RNA methyltransferase family member 2 S homeolog, anticorps Nsun2, anticorps NSUN2, anticorps nsun2.S

Sujet: Maturation of cytoplasmic tRNAs includes splicing of introns, which are located 1 nucleotide 3-prime from the anticodon in all intron-containing tRNA genes. In tRNA-leu(CAA), the first position of the anticodon, C34, is converted to 5-methylcytosine, a modification necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. NSUN2 is a methyltransferase that catalyzes the intron-dependent formation of 5-methylcytosine at C34 of tRNA-leu(CAA).

Poids moléculaire: 86 kDa (MW of target protein)