ALG1L3P anticorps (C-Term)

N° du produit ABIN630743

Détail du produit anti-ALG1L3P anticorps

Antigène: ALG1L3P (Asparagine-Linked Glycosylation 1-Like 3, Pseudogene (ALG1L3P))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALG1L3P est non-conjugé

Application: Western Blotting (WB)

Specificité: LOC650515 antibody was raised against the C terminal of LOC650515

Purification: Affinity purified

Immunogène: LOC650515 antibody was raised using the C terminal of LOC650515 corresponding to a region with amino acids VQTVLPLVMDTELLGQRLKPQGPCCPSRSFFSESQGKSFRVAPPSGQKLI

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LOC650515 Blocking Peptide, catalog no. 33R-9764, is also available for use as a blocking control in assays to test for specificity of this LOC650515 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC650515 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALG1L3P

Antigène: ALG1L3P (Asparagine-Linked Glycosylation 1-Like 3, Pseudogene (ALG1L3P))

Abstract: ALG1L3P Produits

Synonymes: anticorps asparagine-linked glycosylation 1-like 3, pseudogene, anticorps ALG1L3P

Sujet: The sequence of LOC650515 is derived from an annotated genomic sequence (NW_922073) using gene prediction method: GNOMON, supported by EST evidence. The exact function of LOC650515 remains unknown.

Poids moléculaire: 39 kDa (MW of target protein)