GGN anticorps (N-Term)

N° du produit ABIN630747

Cet anticorps anti-GGN est un anticorps Lapin Polyclonal détectant GGN dans WB. Adapté pour Humain, Rat et Souris.

Aperçu rapide pour GGN anticorps (N-Term) (ABIN630747)

Antigène: GGN (Gametogenetin (GGN))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GGN est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GGN anticorps

Épitope: N-Term

Specificité: GGN antibody was raised against the N terminal of GGN

Purification: Affinity purified

Immunogène: GGN antibody was raised using the N terminal of GGN corresponding to a region with amino acids GPSKWQKPAGTPVPRIRRLLEASHRGQGDPPSLRPLKPPPPPRQLSVKDT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GGN Blocking Peptide, (ABIN938870), is also available for use as a blocking control in assays to test for specificity of this GGN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GGN

Antigène: GGN (Gametogenetin (GGN))

Autre désignation: GGN

Sujet: GGN may be involved in spermatogenesis.

Poids moléculaire: 67 kDa (MW of target protein)