CENPP anticorps (N-Term)

N° du produit ABIN630748

Détail du produit anti-CENPP anticorps

Antigène: CENPP (Centromere Protein P (CENPP))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CENPP est non-conjugé

Application: Western Blotting (WB)

Specificité: CENPP antibody was raised against the N terminal of CENPP

Purification: Affinity purified

Immunogène: CENPP antibody was raised using the N terminal of CENPP corresponding to a region with amino acids VQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CENPP Blocking Peptide, catalog no. 33R-9748, is also available for use as a blocking control in assays to test for specificity of this CENPP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CENPP

Antigène: CENPP (Centromere Protein P (CENPP))

Autre désignation: CENPP (CENPP Produits)

Synonymes: anticorps CENP-P, anticorps 1700022C02Rik, anticorps 4921518G09Rik, anticorps si:ch211-103f16.3, anticorps wu:fb81h12, anticorps zgc:101125, anticorps centromere protein P, anticorps CENPP, anticorps Cenpp, anticorps cenpp

Sujet: CENPP is the component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. CENPP may be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.

Poids moléculaire: 33 kDa (MW of target protein)