NUP43 anticorps (Middle Region)

N° du produit ABIN630751

Détail du produit anti-NUP43 anticorps

Antigène: NUP43 (Nucleoporin 43kDa (NUP43))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NUP43 est non-conjugé

Application: Western Blotting (WB)

Specificité: NUP43 antibody was raised against the middle region of NUP43

Purification: Affinity purified

Immunogène: NUP43 antibody was raised using the middle region of NUP43 corresponding to a region with amino acids HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NUP43 Blocking Peptide, catalog no. 33R-3830, is also available for use as a blocking control in assays to test for specificity of this NUP43 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP43 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NUP43

Antigène: NUP43 (Nucleoporin 43kDa (NUP43))

Autre désignation: NUP43 (NUP43 Produits)

Synonymes: anticorps MGC184722, anticorps MGC154553, anticorps 2610016K01Rik, anticorps 2610529I12Rik, anticorps AA409950, anticorps p42, anticorps bA350J20.1, anticorps nucleoporin 43, anticorps nucleoporin 43kDa, anticorps nucleoporin Nup43, anticorps nucleoporin 43kDa S homeolog, anticorps NUP43, anticorps nup43, anticorps LOC696374, anticorps nup43.S, anticorps Nup43

Sujet: NUP43 is the component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.

Poids moléculaire: 42 kDa (MW of target protein)