RPL30 anticorps (Middle Region)

N° du produit ABIN630753

Cet anticorps anti-RPL30 est un anticorps Lapin Polyclonal détectant RPL30 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour RPL30 anticorps (Middle Region) (ABIN630753)

Antigène: RPL30 (Ribosomal Protein L30 (RPL30))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPL30 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPL30 anticorps

Épitope: Middle Region

Specificité: RPL30 antibody was raised against the middle region of RPL30

Purification: Affinity purified

Immunogène: RPL30 antibody was raised using the middle region of RPL30 corresponding to a region with amino acids MLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPL30 Blocking Peptide, (ABIN5615939), is also available for use as a blocking control in assays to test for specificity of this RPL30 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPL30

Antigène: RPL30 (Ribosomal Protein L30 (RPL30))

Autre désignation: RPL30

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL30 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene encoding RPL30 is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron.

Poids moléculaire: 13 kDa (MW of target protein)