HCFC1R1 anticorps

N° du produit ABIN630754

Cet anticorps Lapin Polyclonal détecte spécifiquement HCFC1R1 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour HCFC1R1 anticorps (ABIN630754)

Antigène: HCFC1R1 (Host Cell Factor C1 Regulator 1 (XPO1 Dependent) (HCFC1R1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HCFC1R1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HCFC1R1 anticorps

Purification: Affinity purified

Immunogène: HCFC1 R1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HCFC1R1 Blocking Peptide, (ABIN5613945), is also available for use as a blocking control in assays to test for specificity of this HCFC1R1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HCFC0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HCFC1R1

Antigène: HCFC1R1 (Host Cell Factor C1 Regulator 1 (XPO1 Dependent) (HCFC1R1))

Autre désignation: HCFC1R1

Sujet: HCFC1R1 regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus.

Poids moléculaire: 15 kDa (MW of target protein)