HOXA7 anticorps (C-Term)

N° du produit ABIN630763

Cet anticorps Lapin Polyclonal détecte spécifiquement HOXA7 dans WB. Il présente une réactivité envers Drosophila melanogaster.

Aperçu rapide pour HOXA7 anticorps (C-Term) (ABIN630763)

Antigène: HOXA7 (Homeobox A7 (HOXA7))

Reactivité: Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HOXA7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HOXA7 anticorps

Épitope: C-Term

Specificité: ANTP antibody was raised against the C terminal Of Antp

Purification: Affinity purified

Immunogène: ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANTP Blocking Peptide, (ABIN5612092), is also available for use as a blocking control in assays to test for specificity of this ANTP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANTP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HOXA7

Antigène: HOXA7 (Homeobox A7 (HOXA7))

Autre désignation: ANTP

Sujet: Antp is a sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. It provides cells with specific positional identities on the anterior-posterior axis.

Poids moléculaire: 33 kDa (MW of target protein)