HOXA7 anticorps (C-Term)

N° du produit ABIN630763

Détail du produit anti-HOXA7 anticorps

Antigène: HOXA7 (Homeobox A7 (HOXA7))

Épitope: C-Term

Reactivité: Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HOXA7 est non-conjugé

Application: Western Blotting (WB)

Specificité: ANTP antibody was raised against the C terminal Of Antp

Purification: Affinity purified

Immunogène: ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANTP Blocking Peptide, catalog no. 33R-7700, is also available for use as a blocking control in assays to test for specificity of this ANTP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANTP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HOXA7

Antigène: HOXA7 (Homeobox A7 (HOXA7))

Autre désignation: ANTP (HOXA7 Produits)

Synonymes: anticorps ANTP, anticorps HOX1, anticorps HOX1.1, anticorps HOX1A, anticorps AV118143, anticorps Hox-1.1, anticorps HOXA-7, anticorps Hox-A7, anticorps antp, anticorps hox36, anticorps HOXA7, anticorps Hox1r5, anticorps Hoxa7, anticorps hox1, anticorps hox1a, anticorps hox1.1, anticorps Xhox-36, anticorps XlHbox-3, anticorps homeobox A7, anticorps homeobox A7 L homeolog, anticorps HOXA7, anticorps Hoxa7, anticorps hoxa7.L, anticorps hoxa7

Sujet: Antp is a sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. It provides cells with specific positional identities on the anterior-posterior axis.

Poids moléculaire: 33 kDa (MW of target protein)