APPBP2 anticorps

N° du produit ABIN630772

Cet anticorps Lapin Polyclonal détecte spécifiquement APPBP2 dans WB. Il présente une réactivité avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour APPBP2 anticorps (ABIN630772)

Antigène: APPBP2 (Amyloid beta Precursor Protein (Cytoplasmic Tail) Binding Protein 2 (APPBP2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APPBP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-APPBP2 anticorps

Purification: Affinity purified

Immunogène: APPBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYLLN

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

APPBP2 Blocking Peptide, (ABIN5612128), is also available for use as a blocking control in assays to test for specificity of this APPBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APPBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APPBP2

Antigène: APPBP2 (Amyloid beta Precursor Protein (Cytoplasmic Tail) Binding Protein 2 (APPBP2))

Autre désignation: APPBP2

Sujet: APPBP2 interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. APPBP2 has been found to be highly expressed in breast cancer.

Poids moléculaire: 67 kDa (MW of target protein)