Epsin 2 anticorps (Middle Region)

N° du produit ABIN630778

Cet anticorps Lapin Polyclonal détecte spécifiquement Epsin 2 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour Epsin 2 anticorps (Middle Region) (ABIN630778)

Antigène: Epsin 2 (EPN2)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Epsin 2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Epsin 2 anticorps

Épitope: Middle Region

Specificité: Epsin 2 antibody was raised against the middle region of EPN2

Purification: Affinity purified

Immunogène: Epsin 2 antibody was raised using the middle region of EPN2 corresponding to a region with amino acids SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Epsin 2 Blocking Peptide, (ABIN5613389), is also available for use as a blocking control in assays to test for specificity of this Epsin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Epsin 2

Antigène: Epsin 2 (EPN2)

Autre désignation: Epsin 2

Sujet: This protein interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. It is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: EGFR Downregulation