ALDOB anticorps (Middle Region)

N° du produit ABIN630782

L’anticorps Lapin Polyclonal anti-ALDOB a été validé pour WB. Il convient pour détecter ALDOB dans des échantillons de Humain, Rat et Souris.

Aperçu rapide pour ALDOB anticorps (Middle Region) (ABIN630782)

Antigène: ALDOB (Aldolase B, Fructose-Bisphosphate (ALDOB))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDOB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ALDOB anticorps

Épitope: Middle Region

Specificité: ALDOB antibody was raised against the middle region of ALDOB

Purification: Affinity purified

Immunogène: ALDOB antibody was raised using the middle region of ALDOB corresponding to a region with amino acids KLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALDOB Blocking Peptide, (ABIN939889), is also available for use as a blocking control in assays to test for specificity of this ALDOB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDOB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALDOB

Antigène: ALDOB (Aldolase B, Fructose-Bisphosphate (ALDOB))

Autre désignation: ALDOB

Sujet: Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related 'housekeeping' genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance.

Poids moléculaire: 39 kDa (MW of target protein)