ALDOB anticorps (Middle Region)

N° du produit ABIN630782

Détail du produit anti-ALDOB anticorps

Antigène: ALDOB (Aldolase B, Fructose-Bisphosphate (ALDOB))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDOB est non-conjugé

Application: Western Blotting (WB)

Specificité: ALDOB antibody was raised against the middle region of ALDOB

Purification: Affinity purified

Immunogène: ALDOB antibody was raised using the middle region of ALDOB corresponding to a region with amino acids KLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALDOB Blocking Peptide, catalog no. 33R-4503, is also available for use as a blocking control in assays to test for specificity of this ALDOB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDOB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALDOB

Antigène: ALDOB (Aldolase B, Fructose-Bisphosphate (ALDOB))

Autre désignation: ALDOB (ALDOB Produits)

Synonymes: anticorps aldb, anticorps aldo2, anticorps xaldb, anticorps ALDOB, anticorps aldob, anticorps ALDB, anticorps ALDO2, anticorps Aldo-2, anticorps Aldo2, anticorps BC016435, anticorps LIV10, anticorps fb25f09, anticorps wu:fb25f09, anticorps aldolase B, anticorps aldolase, fructose-bisphosphate B, anticorps aldolase, fructose-bisphosphate B S homeolog, anticorps aldolase b, fructose-bisphosphate, anticorps aldolase B, fructose-bisphosphate, anticorps xaldb, anticorps aldob, anticorps aldob.S, anticorps ALDOB, anticorps Aldob

Sujet: Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related 'housekeeping' genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance.

Poids moléculaire: 39 kDa (MW of target protein)